SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043542 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043542
Domain Number 1 Region: 798-988
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.29e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 500-763
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.27e-46
Family Protein kinases, catalytic subunit 0.00044
Further Details:      
 
Domain Number 3 Region: 37-417
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.59e-39
Family L-arabinose binding protein-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043542   Gene: ENSTRUG00000017007   Transcript: ENSTRUT00000043687
Sequence length 1073
Comment pep:known_by_projection scaffold:FUGU4:scaffold_3:2909762:2918744:-1 gene:ENSTRUG00000017007 transcript:ENSTRUT00000043687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVRAHVYVCECVSVRVLVIALCMHGFTINVILLDDEEAPWSLKYVKGEILKAIETDKTQ
NPEEGLKLNLTANFGGFNTNLYGHRGCKSTTCEGVEELKSLMNSRNLGCSVLGPTCTYAA
FQIVDMEKGLKLSTPIISAGSFGLSCDYTLNLQRLLPPARKISDFFIKFWPETNKLKPDW
RTAYMFKKDINTEDCFWYMNALDAGNFSQKFQRTALYTSHQLNQILQSPHNRTSNLFIMC
GSPQDILEAKNGTKGADKNDILFLLIDLYNDQYYTNTSSMPSMQNVLVLTMPNTRTYKIN
TDFNSSSMMNDYIAAYHDAVLLIGQVMRKILSKNESDVEVMEFMDVNYFRNTSFNGSAGH
YRLDSYGDRDVELSIIYTTTELKYELLFSFDTELNITTVAQNNPAFIWGKTLPNYIPDKA
SESASHDIIVIVLAVTVVVVTTIAFIFYRTVIRDRMIRKRWSHISPDLINLLENNTHNVI
SLTIEDERKKSNFTIQRAFYDKKIVILKELKHSDGNFNETQRIELNALQQIDYYNLTKFY
GTVKLERGVFGVFEYGERGSLRYVLNNLVSYPDNTFMDWEFKISVMYDIAKGMSYLHSSD
IQVHGRLKSTNCVVDNRMVVKITDFGCNSFLSPGKDLWTAPEHLRKQGTSQKGDVYSFAI
IAHEIVLRKCTFYTESCTKRAEKLSRIIMSYFRPDLNFDTASEKELEVCTLIKSCWDEDP
EKRPDFRKVENYLGKIISKIHNQENESYMDNMIRRLQMYSRNLEHLVEERTALYKSERDR
ADCLNFMLLPRPVVKSLKESGVVEPELYEEVTVYFSDIVGFTTLCQYSTPMEVVDMLNDI
YKGFDGIVDLHDVYKVETIGDAYMVASGLPKRNGNRHAVDICHMALDILHFMGTFQLRHL
PGIPVWIRIGVHSGSCAAGVVGVKMPRYCLFGDTVNTASRMESTGHPLRIHVSEPTINIL
QRTNCNFQYEMRGETYLKGKGTETTYWLTGEKGEDYKLPTPPTTENFQRLQQDLAQMILA
CLERRVRGSVRRKKLPSGQSGDEDKGQESEAESDGSHLEYLQMASVDNTLSTF
Download sequence
Identical sequences H2V2W1
ENSTRUP00000043542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]