SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043651 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043651
Domain Number 1 Region: 363-525
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-45
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 134-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 11-64
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000303
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000043651
Domain Number - Region: 83-121
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0761
Family AN1-like Zinc finger 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043651   Gene: ENSTRUG00000017040   Transcript: ENSTRUT00000043797
Sequence length 525
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:4222423:4226299:1 gene:ENSTRUG00000017040 transcript:ENSTRUT00000043797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSASTARERENRKCHLCKVESSEPVTLKCKHRFCRRCIEDLWSTVPNGPYRCPEWRETL
RRRPALQLQTNQAQSVQPFSRSESKSARPVPCHYCPNAVYQPAIKTCLVCGASMCSEHLR
PHLESPVFQNHTLIAPVEDISSWKCQEHQDINRIYCRKCGVCVCTLCPLVGSHQNHECIS
LREAERELRGNLKKDIAQLQQTEDEVIITLNEVTQKKEASRVVLEKARTSVLQQYAAIRE
ALDQEEQTALQCVAKEESRVLGGLEEKLGNLRSSLQSIQKGLHIFEGLADAKGDKHIGDQ
VFVRFHSTGIQQDCPPICFPSPFTLLFLIRSSVLGSYMEHFETPEEVDHARLKCLQKWNG
CVPSLDADTAHPKLQLSDNNREVRYSEAQQPYTEHAARFSSFPQVLASSALQGGRWYWEV
NVSVEEGRWKVGVSEGRIERKGQKDISRLGCNPYSWCLACDKKKVEALHNRVSAPVDADG
LQRVGVFLDFEEGVLSFFNVTPGGSLALVHSYKHSFTDPVYPAFS
Download sequence
Identical sequences H2V370
ENSTRUP00000043651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]