SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043657 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043657
Domain Number 1 Region: 391-554
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-45
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 135-188
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000977
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 5-59
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000544
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043657   Gene: ENSTRUG00000017040   Transcript: ENSTRUT00000043803
Sequence length 555
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:4222498:4226305:1 gene:ENSTRUG00000017040 transcript:ENSTRUT00000043803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LETPARCHLCKVESSEPVTLKCKHRFCRRCIEDLWSTVPNGPYRCPEWRYKYSVGENVPR
CLVCPPPASCFRSPADLGSFSRSESKSARPVPCHYCPNAVYQPAIKTCLVCGASMCSEHL
RPHLESPVFQNHTLIAPVEDISSWKCQEHQDINRIYCRKCGVCVCTLCPLVGSHQNHECI
SLREAEREGNLKKDIAQLQQTEDEVIITLNEVTQKKEASRLLLSVQVVLEKARTSVLQQY
AAIREALDQEEQTALQCVAKEESRVLGGLEEKLGNLRSSLQSIQKGLHIFEGLADAKGDK
HIGDQVFVREYSKTAHLFPSPFTLLFLIRSSVLGSYMEHFETPEEVDHARLKCLQKWTEK
RLDTYLKNRKLACEQCLFIQTSHLCTDGCVPSLDADTAHPKLQLSDNNREVRYSEAQQPY
TEHAARFSSFPQVLASSALQGGRWYWEVNVSVEEGRWKVGVSEGRIERKGQKDISRLGCN
PYSWCLACDKKKVEALHNRVSAPVDADGLQRVGVFLDFEEGVLSFFNVTPGGSLALVHSY
KHSFTDPVYPAFSVS
Download sequence
Identical sequences H2V376
ENSTRUP00000043657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]