SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043860 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043860
Domain Number 1 Region: 40-526
Classification Level Classification E-value
Superfamily Sema domain 6.54e-110
Family Sema domain 0.0000000117
Further Details:      
 
Domain Number 2 Region: 1099-1358
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-78
Family Protein kinases, catalytic subunit 0.000000000901
Further Details:      
 
Domain Number 3 Region: 668-756
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000104
Family Other IPT/TIG domains 0.074
Further Details:      
 
Domain Number 4 Region: 528-575
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000916
Family Plexin repeat 0.00069
Further Details:      
 
Domain Number 5 Region: 571-638
Classification Level Classification E-value
Superfamily E set domains 0.0000000242
Family Other IPT/TIG domains 0.059
Further Details:      
 
Domain Number 6 Region: 754-845
Classification Level Classification E-value
Superfamily E set domains 0.000000117
Family E-set domains of sugar-utilizing enzymes 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043860   Gene: ENSTRUG00000017114   Transcript: ENSTRUT00000044006
Sequence length 1401
Comment pep:known scaffold:FUGU4:scaffold_2:4528069:4564787:1 gene:ENSTRUG00000017114 transcript:ENSTRUT00000044006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMNLCSFPAAVLLLWALSASAEGHCQKSPEPNKLNLSVSYELPTFTAEFPIQNVVTLDGI
IYVGATNRIYALAPSLTKLSEYRTGPLLANQTCGQKVANASSGGGRKDNLNVALVVENIY
DKGLFSCGSADNGVCRRHVLEDDVSLDEEGRQKSVDELVYCFTDLKQDKGQPRDSDVVVS
PSGSQVLNVESNMIMFFVGNSEIPGSGNVTGPTARPHTMSLRKMKTSQNGFTFFSNRSYM
DLIPPLRGSYYLRYVYSFHSGPFTYFLTVQQVSKDSQTYHTRIVRMCSSDHDIRRYVEMP
LECISTDKRRRRSMEDVKVFNILQAATVTKVGSDVELQRQLRLEEGDDVLFAAFARGKPN
STEATPNSAICVMSLKLINSMFKMYMQKCNTVDLYHFTGSDKKSCYNVKLSRRENPAMFC
KGKEGKYRLQVTQFVQRLEYWQKVLTNTLVTSITVVTVHGRAVGYLGTADGRHIQVKVAF
SRFASPHVNIRLDSRPVSGSVVLPGQDPSEGALLLTTGNKITKVPLIGPGCDHLTTCTSC
LVSSRVTECGWCEGRCTRANQCPPSVWTQEYCTPVVTKVFPTSGPIRGSTTVTMCGRNFG
FDKTESFKASLVTVEVAGVPCKLSRQDYASRWTEIQCSPMFSGNFMPSGHTVKVTSGHKI
ATIEGFTFVDPVVSEIFPTFGPKSGNTMLTIRGAFLDTGNKREVTVGKAACKIQSLSATM
LTCKTPPHAVPSKQPVRLTVDSVARDAPVLYTYHQDPIISSIQPSRSFVSGGCTVAAHGL
FLQSGLQPQMVLTTGQDAEVFHVSCVYGENRTSIQCTTPSLAKLALQPPVVTKVAFVLDG
YMTEQWDLIYVEDPLFQDPKLTSKDNKSIVELKGDRMDREAMKCQVLTVSNHSCESLTLV
GNTLECTVPTELQTTTSKELQVEWRQADSIRHLGKVTLAQEQDYTGLIVGCMCVSLLLLL
LGTLLLWKKNKHIDDLSEVWYDGRGHIQHLDRLANARSVSPTNEMVSHESVDYRTNLLED
QGSDRPETCRAGPPIYGGNGELLSPRLVALGSGLGLGMEGELVSPLLMAPVHIDPSCLHP
DLLTEVQHVVIAREQLLLHLNQVIGRGHFGCVFHGTLLEPDGQKQHCAVKSLNRITDLEE
VSQFLKEGIIMKDFSHPNVLSLLGICLPPEGSPLMVLPYMKHGDLRNFIRDESHNPTVKD
LMGFGLQVARGMEYLASKKFVHRDLAARNCMLDESYTVKVADFGLARDVYDKEYYSVHNK
SGVKLPVKWMALESLQTHKFTSKSDVWSFGVLLWELMTRGAPPYSDVNSFDITVFLLQGR
RLLQPEFCPDALYTVMIECWHPNPERRPSFSELVEPISSIFSSFSGEHYILLNTTYVNIE
KLNPYPSLFASTHLTPSSSSL
Download sequence
Identical sequences H2V3S6
ENSTRUP00000043860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]