SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043879 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043879
Domain Number 1 Region: 39-192
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000000432
Family Toll/Interleukin receptor TIR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043879   Gene: ENSTRUG00000017124   Transcript: ENSTRUT00000044026
Sequence length 192
Comment pep:novel scaffold:FUGU4:scaffold_1:4391289:4392021:1 gene:ENSTRUG00000017124 transcript:ENSTRUT00000044026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLAVSVGCVVFFMISVVIVYAKFKIYMVLFLRDTLGCHRSSSDGKSYDAFLMCYKSDTD
GGLNEQDKCFLESVLEERFGYSLCLYDRDVLPGNAAPDAVLDSIEQSRTVVLIPTSSDSC
LESGLLIAVHSALVEHRTRLVFIQTNVEQGTCSGSVSEALQLLAEAGDRVTWKGSSSVPL
SSSFWKRLRYYL
Download sequence
Identical sequences H2V3U5
31033.ENSTRUP00000043879 ENSTRUP00000043879 ENSTRUP00000043879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]