SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043959 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043959
Domain Number 1 Region: 218-357
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-32
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 2 Region: 365-501
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-29
Family C-type lectin domain 0.00072
Further Details:      
 
Domain Number 3 Region: 823-949
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-29
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1243-1381
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-28
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 5 Region: 1112-1232
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-25
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 6 Region: 665-808
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-25
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 7 Region: 512-651
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-23
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 8 Region: 961-1102
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-23
Family C-type lectin domain 0.0029
Further Details:      
 
Domain Number 9 Region: 38-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.06e-21
Family Cysteine rich domain 0.017
Further Details:      
 
Domain Number 10 Region: 162-220
Classification Level Classification E-value
Superfamily Kringle-like 2.26e-20
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043959   Gene: ENSTRUG00000017160   Transcript: ENSTRUT00000044107
Sequence length 1471
Comment pep:known_by_projection scaffold:FUGU4:scaffold_1:4481844:4492772:1 gene:ENSTRUG00000017160 transcript:ENSTRUT00000044107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAVATVCAVLWLLKICSCATDQSDEALDKKQLTEFYKKGLFLLESEPLKRCITVDRSNLV
LGDCERPTRSMLWKWVSQHRLFNLGTSTCLGLNLSNKTQPLGTFRCDTTLSVLWWRCSGK
ILQGASQWKVTVTGRLVVVKRNAHHLWKRYNTDREGPCSRPYEDIHTLLGNAHGMPCALP
FKYNNKWYYECTAEGRDDHLLWCATSTHYDDTKKWGFCPVPGYSCDHFWETNQKLQACYQ
FNLYTILTWSQAQSTCHAQGGNLLSITSLAEQSYIRDRLASIGAMVWIGLNHLKDGRGWQ
WSDGAPLSLVNFTTALPASPLQDNRQCGVYNSAYEGHWQSLSCESALPYICKKTPNDTRR
AEPLENWQYIHTECSSGWWPHKGFCYRLLSETEGTWEESSEACNSRGANLTSIRSLSEVE
MLLDLLANYSGDSTEVWIGLWKRGSSPTVEWSDGSPVTLTLWHQYHPPPNQTDILCAKAD
RKEGNWLLVSCDERLPALCRRKSQTPINHSENLDTGCPEGWERHRHSCYTVTNQEQINED
ARIGYYCHGHLLTVEDRFEQAFVNSLLSASGANSSLYYWIGLMSTDDDDDDDGTYIWDHN
TDPPVPLTFTNWNKHQPVSGSGCVVMSGGPALGRWEVKNCRTFKALSLCKQSIHNDNDFQ
LPQHFNHPNAPCPPGWESQAELLLCFKVFHDEKVLMKRSWVEADFFCQALGAQLTSFTHY
KEQMFVKQLLSTMFDGEEGRSFWVGLNKRDPEHPGAWEWSDNTPVVTTFIEDKAEDDDRR
HCAVYSYLTDAFVPQLCDAKHEWICKIAKGEKLKKPYWYIEHSEPWVFYHGAEYLLVQQP
FDWDSVSLACQMMGAYLLSIHSRDELHFIKEHLRRLSLGPTDWWIGLSIGPPGEEVRWSD
RTEVEFQNWAQASALGPRKDRMCATMSSSSGKWLRSKCNELHGYVCKRKTVSVLETRREP
HYIGRCPEKWLYFGHKCLLLHLPSSPKEGKTWKDAESICSSFESSLVTIDSEIEQAFITM
LLQGSAVGVWISLKWTGYRNWSPINEVNVYCYIYFANPQEEPLCTVLSNNHNIHMTGKWY
DEKCSESGYGFVCQKLQDTTKSPTHSYHHPLPNNIEYRGHNYRVISGNLSWYNAMVMCRE
NHFDLVSIMDAYHQAFLTVLVNRLGAPHWIGLHSELPGGISYKWSDGSETVYTHWDAEDD
EDALAEDCVYVDVNGRWRRADCETLLPGALCQEMHPSQCFDKPFISNDVVCPTTWVKFGQ
ICYNFDPVVYQLTFEKSREHCRLMANNSDVLTIMSDQENRFVLEQLWTLGLLHQTVWLGM
DFNQDNNSMVWVDGSPVDYNNWPNKSPDPKLVFPDTCVTTRGVDGVWHLSQCTEQLGFIC
KTTTKANDMVEVESLKGRKDSGFHHSAIPAAVLGAVLIFALLAGATWLAYKKNALCFRGL
PPIGSIYYRQSGTHTDSDGNVLITDLSPYSG
Download sequence
Identical sequences H2V425
ENSTRUP00000043959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]