SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043960 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043960
Domain Number 1 Region: 941-1077
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-32
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 2 Region: 193-332
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-32
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 340-476
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-29
Family C-type lectin domain 0.00072
Further Details:      
 
Domain Number 4 Region: 799-931
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-29
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1221-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-26
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 6 Region: 640-786
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-24
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1091-1210
Classification Level Classification E-value
Superfamily C-type lectin-like 7.56e-24
Family C-type lectin domain 0.0027
Further Details:      
 
Domain Number 8 Region: 487-626
Classification Level Classification E-value
Superfamily C-type lectin-like 9.97e-24
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 13-137
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.01e-21
Family Cysteine rich domain 0.017
Further Details:      
 
Domain Number 10 Region: 137-195
Classification Level Classification E-value
Superfamily Kringle-like 2.23e-20
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043960   Gene: ENSTRUG00000017160   Transcript: ENSTRUT00000044108
Sequence length 1450
Comment pep:known_by_projection scaffold:FUGU4:scaffold_1:4482707:4507847:1 gene:ENSTRUG00000017160 transcript:ENSTRUT00000044108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRYCLFFVFIPEKGLFLLESEPLKRCITVDRSNLVLGDCERPTRSMLWKWVSQHRLFNLG
TSTCLGLNLSNKTQPLGTFRCDTTLSVLWWRCSGKILQGASQWKVTVTGRLVVVKRNAHH
LWKRYNTDREGPCSRPYEDIHTLLGNAHGMPCALPFKYNNKWYYECTAEGRDDHLLWCAT
STHYDDTKKWGFCPVPGYSCDHFWETNQKLQACYQFNLYTILTWSQAQSTCHAQGGNLLS
ITSLAEQSYIRDRLASIGAMVWIGLNHLKDGRGWQWSDGAPLSLVNFTTALPASPLQDNR
QCGVYNSAYEGHWQSLSCESALPYICKKTPNDTRRAEPLENWQYIHTECSSGWWPHKGFC
YRLLSETEGTWEESSEACNSRGANLTSIRSLSEVEMLLDLLANYSGDSTEVWIGLWKRGS
SPTVEWSDGSPVTLTLWHQYHPPPNQTDILCAKADRKEGNWLLVSCDERLPALCRRKSQT
PINHSENLDTGCPEGWERHRHSCYTVTNQEQINEDARIGYYCHGHLLTVEDRFEQAFVNS
LLSASGANSSLYYWIGLMSTDDDDDDDGTYIWDHNTDPPVPLTFTNWNKHQPVSGSGCVV
MSGGPALGRWEVKNCRTFKALSLCKQSIHNDNDFQLPQHFNHPNAPCPPGWESQAELLLC
FKVFHDEKVLMKRSWVEADFFCQALGAQLTSFTHYKEQMFVKQLLSTMFDGEEGRSFWVG
LNKRDPEHPGAWEWSDNTPVSAEIAAYLIDKAEDDDRRHCAVYSYLTDAFVPQLCDAKHE
WICKIAKVALSSPFPLDTPTDSEPWVFYHGAEYLLVQQPFDWDSVSLACQMMGAYLLSIH
SRDELHFIKEHLRRQLSLGPTDWWIGLSIGPPGEEVRWSDRTEVEFQNWAQASALGPRKD
RMCATMSSSSGKWLRSKCNELHGYVCKRKTVSVLETRREPHYIGRCPEKWLYFGHKCLLL
HLPSSPKEGKTWKDAESICSSFESSLVTIDSEIEQAFITMLLQGSAQTVWLGMDFNQDNN
SMVWVDGSPVDYNNWPNKSPDPKLVFPDTCVTTRGVDGVWHLSQCTEQLGFICKTTTSKK
SVSPPPTDKTVSFVSVGNHTFLLLVKNVTWFEALEQCLSNNMDLASIGDTFQQSILTVSV
SRARTPMWIGLFSEDDGIHYRWTDHSHTVFSRWPSETTSGACVYLDTDGFWKATECEEQL
GGAICHKPHQEVITKPEDVAVKCPHNMNGPNWIPFRNNCYAFQLVSTRWAKFDEGHIQET
CTHLYDGANILTIRNAEESNFVARQLLPFRTLAQFVWLGLFKQANDTQMKWFDGTNVQYS
NWDKGRPNRTEQRCPVMTGDEGTWNFVNCKTAYSRVVCKTEAGEYRLKLKSESPCARTSG
DSVENRRTSPWSAGSSAVLVLFIITVIALLVIAAVVVYKKKRGHFSSTIRYERTLDDMDT
TSIITDTELS
Download sequence
Identical sequences H2V426
ENSTRUP00000043960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]