SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044666 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044666
Domain Number 1 Region: 220-470
Classification Level Classification E-value
Superfamily Caspase-like 1.79e-77
Family Caspase catalytic domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 88-170
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000235
Family DEATH effector domain, DED 0.022
Further Details:      
 
Domain Number 3 Region: 1-78
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000694
Family DEATH effector domain, DED 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044666   Gene: ENSTRUG00000017426   Transcript: ENSTRUT00000044817
Sequence length 472
Comment pep:known_by_projection scaffold:FUGU4:scaffold_100:177074:180712:1 gene:ENSTRUG00000017426 transcript:ENSTRUT00000044817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQARLLKVGNDLRKDEVRALVFLCSDILGCNPAAVQSAGDLFSRLSDQDHLSEEQPHL
LVELLGIIQRTKLLRDHNLPRTGAQDLISPYRKLLYSLSEELTADDLKDIKFLLNNKLPR
GKLEEVTTLEVFMELEHRALISDTDLGFLESIIQPVCPVLLEKINQFNAQNYTAQSFVAD
LTIEEMFLDDTQMKSDASVIFPQENQTSPGAETSVTGSADAGVETYLMTAAKRGRCLIIN
NCNFRVSRLKKREGTMVDEASLDKVLKWLGFEVEIQRDCTSKKMSSLIQELAKTSQRDWD
CVMCCVLSHGLEGGVYGVDGGTVEIRKLMEPFSGTNCPSLAGKPKIFFIQACQGSRQQDI
VYTDAGTPGHGYVDNNAVQAKECIPSHADFLLGMATVPSFVSFRDGTHGTWYIQSLCQNL
ADMVPRGCDLISILTKVNADVSKKVAWIDSGHKTQMPQPAFTLTKKIVFPAP
Download sequence
Identical sequences H2V632
ENSTRUP00000044666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]