SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044668 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044668
Domain Number 1 Region: 234-484
Classification Level Classification E-value
Superfamily Caspase-like 1.94e-77
Family Caspase catalytic domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000883
Family DEATH effector domain, DED 0.0062
Further Details:      
 
Domain Number 3 Region: 103-182
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000112
Family DEATH effector domain, DED 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044668   Gene: ENSTRUG00000017426   Transcript: ENSTRUT00000044819
Sequence length 493
Comment pep:known_by_projection scaffold:FUGU4:scaffold_100:177350:180867:1 gene:ENSTRUG00000017426 transcript:ENSTRUT00000044819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQARLLKVGNDLRKDEVRALVFLCSDILGCNPAAVQSAGDLFSRLSDQDHLSEEQPHL
LVELLGIIQRTKLLRDHNLPRTGAQDLISPYRCPVRIIISKSRKLLYSLSEELTADDLKD
IKFLLNNKLPRGKLEEVTTLEVFMELEHRALISDTDLGFLESIIQPVCPVLLEKINQFNA
QNYSAEHRLSLEADADAPLHICNCHPVKSDASVIFPQENQTSPGAETSVTGSADAGVETY
LMTAAKRGRCLIINNCNFRVSRLKKREGTMVDEASLDKVLKWLGFEVEIQRDCTSKKMSS
LIQELAKTSQRDWDCVMCCVLSHGLEGGVYGVDGGTVEIRKLMEPFSGTNCPSLAGKPKI
FFIQACQGSRQQDIVYTDAGTPGHGYVDNNAVQAKECIPSHADFLLGMATVPSFVSFRDG
THGTWYIQSLCQNLADMVPRGCDLISILTKVNADVSKKVAWIDSGHKTQMPQPAFTLTKK
IVFPAPNTPHPVL
Download sequence
Identical sequences H2V634
ENSTRUP00000044668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]