SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000045328 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000045328
Domain Number 1 Region: 424-642
Classification Level Classification E-value
Superfamily ARM repeat 0.000000093
Family HEAT repeat 0.081
Further Details:      
 
Domain Number 2 Region: 5-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000312
Family Galactose-binding domain 0.084
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000045328
Domain Number - Region: 203-245
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00732
Family C-terminal UvrC-binding domain of UvrB 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000045328   Gene: ENSTRUG00000017688   Transcript: ENSTRUT00000045480
Sequence length 894
Comment pep:known_by_projection scaffold:FUGU4:scaffold_387:130134:149275:-1 gene:ENSTRUG00000017688 transcript:ENSTRUT00000045480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKIGFTVVDSSSHEENFSASELMHHAPTVSGWRSSRLCSYPQHITLQLVERSWVRKLQ
LLAHQYLIPTKVEFHIGDTPPDASSPGFPGQLCGLGCVSLCNNENTSFKARELKSGHVDA
FGTYLRITFHRNHVNRYNKYNQVALIAFNVLGETVDGREFNTVPSRGQLIEHDLNSTQLE
ATLDTFMGNYDSISLLDDLAFDMYQDPEVAHIIRVLDQKKQEAVRQENYEEAKNLKQAIA
DLQKVGEMLARYDVEKQCAIEKRDYELAKKKQELMEDYRRRVYQQLEVYNLLDMAMSVLQ
IMTALKSSSGRHPSSLQSSPGHCAAPTKALLSTETLRSSPQGQSSDAGSVAPHSSSLPVS
PCSPSAASHTDVADVPYDERPLPTLQSPAEQHSPLSDTQRSPNGLDMSGEPEPLSEMAQR
QAGLAVEVFGESLVACAYSKTWGYRESAMLNVYKKLLGLSPNTSKEELRNMIRAAVFLVK
RALLDKVSPVFHAALKLLRLLLSQLLSGLGRTEMSRCLEQTWPSLLARTGGPSAHLRAAV
TAFILEIAVLKDVRALHIIPGELVKPFRSSVPPRLAQSRVEMVEKLLAELGTENSGFTLE
NVMTFCTAAMVHSAPVVREVAVRIILLVYRQHGAAVVSYLPPRDAAVRKNFLYKTLFNEF
AKIDGKLVETQARIPHLVLHHENTEEGEIQRTEKCKHVCVPTVGCHDVQTVPSSQGWETK
AMEKRSRKMRPSLRNIPKKSLNHLDKLCIFCGETDESFTDEGLDLHYWTHCPMLRHCDEC
KQVVEIASVTEHLLSECGSRSKFRQCVRCSEAVLAEDLPRHAQGPTCNPPTSGKASSHCP
LCHNNFMPGDEAWKAHLMARGGCKQNSRRPAASQRSLPTQGKAFMAPPLTRSSP
Download sequence
Identical sequences H2V7Y9
ENSTRUP00000045328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]