SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046395 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046395
Domain Number 1 Region: 963-1176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-106
Family Thrombospondin C-terminal domain 0.00000000339
Further Details:      
 
Domain Number 2 Region: 30-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-38
Family Laminin G-like module 0.00000048
Further Details:      
 
Domain Number 3 Region: 840-961
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.22e-36
Family TSP type-3 repeat 0.000000306
Further Details:      
 
Domain Number 4 Region: 759-842
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.49e-17
Family TSP type-3 repeat 0.0000877
Further Details:      
 
Domain Number 5 Region: 491-549
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.58e-16
Family TSP-1 type 1 repeat 0.0000675
Further Details:      
 
Domain Number 6 Region: 438-487
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000471
Family TSP-1 type 1 repeat 0.0000996
Further Details:      
 
Domain Number 7 Region: 318-375
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000178
Family VWC domain 0.0045
Further Details:      
 
Domain Number 8 Region: 383-431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 9 Region: 696-755
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000562
Family TSP type-3 repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000046395
Domain Number - Region: 550-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046395   Gene: ENSTRUG00000018123   Transcript: ENSTRUT00000046553
Sequence length 1178
Comment pep:known_by_projection scaffold:FUGU4:scaffold_78:376799:384857:-1 gene:ENSTRUG00000018123 transcript:ENSTRUT00000046553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKLTGIFLLLILWTCECTRELAESRDDNSVYDLFELVQVPRKNHGVTLVKGDDPYSPAY
KILNPDLIPAVPDNAFSDLIDSIHAERGFILMLNFKQFKRTRGSLLTVEKKDGSGPVFEV
ISNGKANTLDIVFSTENKQQVVSIEDVDLATSHWKNITLFVQEDQAQLYVGCEDVNTAEL
DAPIHSILTQETPASARLRIGKGAVNDRFMGVLQNVRFVFGTTLDAILRNKGCQNSVTSE
TMILENLNGSSAIRTEYTGHKTKGEDLQMVCGFSCEDLISMFKELKSLGVVVKELSNELR
QLTDENKLIKNRIGIHNGVCIHNGIMHKNRDEWTVDDCTECTCQNSATVCRKISCPVISC
TNATIPDRECCPHCGTPSDSAEDSWSPWSEWTHCSASCGRGIQQRGRSCDRINNNCEGTS
VQTRDCYLQECDKRFKQDGSWSHWSPWSSCSVTCGAGVITRIRLCNSPMPQFGGKSCTGE
GRQTEKCQKSPCPINGNWGPWSPWDTCTLTCGGGVQIRKRLCNDPEPKHGGKECVGDAKD
IQACNNKSCPIDGCLSNPCFAGVKCTSFHDGSWKCGKCPVGYSGNGVKCKDIDEKQCKEV
PDTCFKFNGVHRCENTDPGYNCLPCPPRYSGPQPYGKGVEQAVAKKQVCTPRNPCLDGSH
ECNKNARCNYLGHFADPMYRCECKPGYAGNGHICGEDTDLDGWPNSDLICVENATYHCKK
DNCPNLPNSGQEDYDKDGIGDACDNDDDNDGIPDDRKKQDNCPFVYNPRQYDYDRDDVGD
RCDNCPYNSNPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYVYNVDQRDTDLDGVGDM
CDNCPLEHNPDQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGD
ACDHDDDNDGIPDEKDNCRLAFNPDQLDSDGDGRGDVCKDDFDQDKVPDIYDVCPENVDI
SETDFRKFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNSVDFSGTF
FINTERDDDYAGFVFGYQSSSRFYVVMWKQITQTYWSNKPTKAQGYSGLSIKVVNSTTGP
GEHLRNALWHTGNTAGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGLIRVLMYEGKKIM
ADSGNIYDKTYAGGRLGLFVFSQEMVYFSDLKYECRGK
Download sequence
Identical sequences H2VB03
ENSTRUP00000046395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]