SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046579 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046579
Domain Number 1 Region: 24-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.55e-33
Family PDI-like 0.0022
Further Details:      
 
Domain Number 2 Region: 164-273
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.46e-32
Family PDI-like 0.004
Further Details:      
 
Domain Number 3 Region: 284-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000123
Family Glutathione peroxidase-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046579   Gene: ENSTRUG00000018200   Transcript: ENSTRUT00000046737
Sequence length 447
Comment pep:known_by_projection scaffold:FUGU4:scaffold_94:846878:849737:-1 gene:ENSTRUG00000018200 transcript:ENSTRUT00000046737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAATMRPLLLGVLGCSLLLSVRAFYSPDDDVVELTPSNFNKEVIQSDALWLVEFYAPWC
GHCRNLVPDWKKAAAALKGIVKVGAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQ
GGRSSQAIVDGALSALRSLVKERLSGGSSGSGYNKQQQSGSGGSKKDVVELTDDNFDQMV
LESGEVWMVEFFAPWCGHCKNLEPEWTAAATAVKEQTKGKVRLGAVDATVHQVVSSRYGI
RGFPTIKIFRKGEEPEDYQGGRTRADIIERALDLFSDNAPAPELLEILNEDVVKKTCEDS
QLCVIAVLPHILDTGATGRNGYLEVMMKMADKYKKKMWGWLWAEAGAQLELEASLGIGGF
GYPAMAAINTRKMKYALLKGSFSETGIHDFLRELSVGRGSTATFGGGAMPNIQSVDAWDG
KDGQLPEEEEYDLSDVDMDEDFDKDEL
Download sequence
Identical sequences H2VBI7
31033.ENSTRUP00000046579 ENSTRUP00000046579 ENSTRUP00000046579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]