SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046627 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046627
Domain Number 1 Region: 323-538
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-62
Family Nuclear receptor ligand-binding domain 0.0000000895
Further Details:      
 
Domain Number 2 Region: 187-269
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-28
Family Nuclear receptor 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046627   Gene: ENSTRUG00000018219   Transcript: ENSTRUT00000046785
Sequence length 554
Comment pep:known_by_projection scaffold:FUGU4:scaffold_78:572883:580515:-1 gene:ENSTRUG00000018219 transcript:ENSTRUT00000046785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRQSPAQSRQSCGPVVKARISPAFTELETLSLQRPSPPLRALLNDMYPEESRGSGGVA
SVDYLEGTYDYAAPTAATTPLYSHSNSGCYSLDSHGPPSDGSLHSLGSGPTSPLVFVPSS
PRLSPFMHPPSQHYLEATSTPVYRSAIVSSQDSVSREDQCGTSDGAFGMGEAVVGAGSAG
FELAKEMRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDRNRRK
SCQACRLRKCYEVGMMKGGVRKDRIRVIRRDKRTPGTGGRENSSKDVQHKTAPPQDRRKQ
HSSSGTGGAGGKSAVPGLAPEQILFQLQGAEPPMLCSRQKLSRPYTEVTMMTLLTNMADK
ELVHMIAWAKKIPGFVQLSLHDQVKLLESSWLEVLMIGLIWRSIHYPGKLIFAPDLILDR
NEGDCVEGMAEIFDMLLATTSRFRMLKLKPEEFVCLKAIILLNSGAFSFCTGSMEPLHDN
AAVQNILDNIMDALIHHIGQSGFSAQQQSRRQAQLLLLLSHIRHTSNKGMEHLYSMKYLL
QPKCTSFSDLRGRL
Download sequence
Identical sequences H2VBN5
ENSTRUP00000046627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]