SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000047490 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000047490
Domain Number 1 Region: 126-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-76
Family Nuclear receptor ligand-binding domain 0.00000000199
Further Details:      
 
Domain Number 2 Region: 73-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.54e-27
Family Nuclear receptor 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000047490   Gene: ENSTRUG00000018545   Transcript: ENSTRUT00000047651
Sequence length 481
Comment pep:novel scaffold:FUGU4:scaffold_47:1504109:1513129:-1 gene:ENSTRUG00000018545 transcript:ENSTRUT00000047651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMEALGLAPRPLYDVSGQGSCMLAKATPYFSGLDPFAWAGTSSIQSVETQSTSSEEM
VPSSPSPPPPPRIYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQ
INKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKDVKEEVVLPENYELSGELEELVNK
VSKAHQETFPSLCQLGKYTTNSSSDHRVQLDLGLWDKFSELSTKCIIKIVEFAKRLPGFT
TLTIADQITLLKSACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVF
AFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALKIYTRRRRPNK
PHMFPRMLMKVTDLRGISTKGAERAITLKTEIPGPMPPLIREMLENPEAFEDSSDSGDSA
SAAAPPAIQAIKQEETTRCESTIEEEEEDEHWDEDKDRSADSDWESCGEAVVDLQKQGKP
Q
Download sequence
Identical sequences H2VE45
ENSTRUP00000047490 ENSTRUP00000047490 31033.ENSTRUP00000047490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]