SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000047491 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000047491
Domain Number 1 Region: 127-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-76
Family Nuclear receptor ligand-binding domain 0.00000000199
Further Details:      
 
Domain Number 2 Region: 74-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.22e-27
Family Nuclear receptor 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000047491   Gene: ENSTRUG00000018545   Transcript: ENSTRUT00000047652
Sequence length 442
Comment pep:novel scaffold:FUGU4:scaffold_47:1504232:1516784:-1 gene:ENSTRUG00000018545 transcript:ENSTRUT00000047652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLHHVTKFSRAMYPFTFNSMRSHSPFDFLASSHLFGQFGADLPKEMAALSVETQSTSSEE
MVPSSPSPPPPPRIYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNC
QINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKDVKEEVVLPENYELSGELEELVN
KVSKAHQETFPSLCQLGKYTTNSSSDHRVQLDLGLWDKFSELSTKCIIKIVEFAKRLPGF
TTLTIADQITLLKSACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLV
FAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALKIYTRRRRPN
KPHMFPRMLMKVTDLRGISTKGAERAITLKTEIPGPMPPLIREMLENPEAFEDSSDSGDS
ASAAAPPAIQAIKQEETTRCES
Download sequence
Identical sequences H2VE46
ENSTRUP00000047491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]