SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000047574 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000047574
Domain Number 1 Region: 820-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family Laminin-type module 0.00084
Further Details:      
 
Domain Number 2 Region: 268-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 927-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 4 Region: 876-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 5 Region: 722-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 6 Region: 427-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 380-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 765-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.00089
Further Details:      
 
Domain Number 9 Region: 324-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 10 Region: 975-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000047574
Domain Number - Region: 680-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 83-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0264
Family CBM4/9 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000047574   Gene: ENSTRUG00000018579   Transcript: ENSTRUT00000047735
Sequence length 1610
Comment pep:known_by_projection scaffold:FUGU4:scaffold_49:1256385:1310288:-1 gene:ENSTRUG00000018579 transcript:ENSTRUT00000047735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPVLCFLLALHLSCHLLVRAAMDACYDEEGTPSRCMPKFENIAFNRTVVVSNVCGSPPEE
FCMQTGSTRSCHQCDAADPERSHNAPLLTDFHRNEESTWWQSQSMYFGIQHPNSVNLTLH
LGKAFEITYVRLKFYTSRPESFAIYKRTQEEGPWLPYQYYSASCKKTYGKQANAYIRPGD
DERSALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSLLLQEWVTATDLLISLDRLNT
FGDEFFKDPKVLRSYFYGISDFSVGGRCKCNGHASECSEGEQGRLLCVCQHHTAGDDCQR
CHPFYQDRPWARATGDSANECLICNCSGRSDQCVFDAEQYRSTGSGGRCLSCRDLTDGPH
CERCRENHYRTSAEEPCLPCICNINGSVSLQCDAEGKCACRTGVTGEKCDKCAAGFHSLG
PAGCRPCECDPSGSVGDCSPSDGGCDCKANVEGQSCGRCKPGFYNLRGVNPEGCQACFCF
GHSLACSSSSHHVVANITSDFLEDQDGWLGEFFGGQSYPLLWKEGEVYLLPLSEDDIGFY
KAPEKFLGRQVYSYGQLLTITFTSETAELLPNNVTLLLQGSAVGLHLRDCSISRAQSGPQ
VAGTAQQRTATFIKQAPMLHEQEGFEPALSAFEFQTFLYNLTDLRISNAGGRNYTSQLTS
VTLISAAISDKLSGPHARWVESCTCPPGFAGQFCEQCAPGFTRQDPGGGPLSPCVPCNCH
QHGTCHQETGVCNCSDFTAGKACERCLEGYYGNALIGMPGDCQPCPCPDQSSCAQIVSTG
QVVCTNCPRGQTGMRCQLCEDGYYGDPLGRSGAARPCERCDCNGNVDPNALGVCDHASGR
CLKCLGHTEGHHCERCQRGFYGDALDPTAGKKCKPCSCHPAGTSGDVSECHPQTGRCRCL
AHVTGRVCASCEVGFFNLQPGVGCERCQCNPVGSSSPACHPITGQCVCRAGVEGTLCHTC
RTGFFGFSSRGCRACNCDPMGSVSMQCHNNGTCRCRRGFVGYKCDKCELNYFHNRATHQC
EECPVCYGLVQKQAEKLRNRLQDLENLLARFDCRSRSGRHLPYPRRPAAEQQREESLPKA
REAFIKQFSSLEASTGRLVAQLHGVTSALNCSLAVTEGGSTRSEASGKAEGVCQSFTEAA
LVIRRAQKQLQQATLDLDNMVIPFEMGSEPNQWNMMVNESQVLLQSRRDTAEHIGVVAGS
AVNASKQALGLLMGLLQDNSTEEYIGNLTERYIKDRKYTKTERPSIAEMQEQTETLAEQT
DAAVAEQLTLEAEAGALRRALRADELLRQTAELHLRLQARDELLVQMEEERRPLEQAARD
KEEVLDVASEVRRSAVTFLLFHQLQARTHEAKVVALASVVEGKDVESSAMLLRRQLEDMV
SEWPRRRAQTQSALKKERPLENKILASIEKRVSHIQEMLEPAAENSSVSRKVAKEAAETA
DAVAKESKDVLTQAKHARTASAHLGSHIDSALQRLVEQEALTGAAHSQITEVLDRPKVSL
GAVKEDMEAARLELAAYSDTLTQLINKIDESVPLERFDRILNETARRLRMLRGSVESPHL
GRKIQKLHLAAEEQRSQMSLIDQDLQDIREERDSLRDIASNLPRACPSAE
Download sequence
Identical sequences H2VEC9
31033.ENSTRUP00000047574 ENSTRUP00000047574 ENSTRUP00000047574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]