SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000047575 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000047575
Domain Number 1 Region: 812-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family Laminin-type module 0.00084
Further Details:      
 
Domain Number 2 Region: 268-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000022
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 919-961
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 4 Region: 868-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 5 Region: 714-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 6 Region: 427-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 380-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 757-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.00089
Further Details:      
 
Domain Number 9 Region: 324-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 10 Region: 967-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000047575
Domain Number - Region: 672-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 83-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0261
Family CBM4/9 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000047575   Gene: ENSTRUG00000018579   Transcript: ENSTRUT00000047736
Sequence length 1602
Comment pep:known_by_projection scaffold:FUGU4:scaffold_49:1256385:1310288:-1 gene:ENSTRUG00000018579 transcript:ENSTRUT00000047736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPVLCFLLALHLSCHLLVRAAMDACYDEEGTPSRCMPKFENIAFNRTVVVSNVCGSPPEE
FCMQTGSTRSCHQCDAADPERSHNAPLLTDFHRNEESTWWQSQSMYFGIQHPNSVNLTLH
LGKAFEITYVRLKFYTSRPESFAIYKRTQEEGPWLPYQYYSASCKKTYGKQANAYIRPGD
DERSALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSLLLQEWVTATDLLISLDRLNT
FGDEFFKDPKVLRSYFYGISDFSVGGRCKCNGHASECSEGEQGRLLCVCQHHTAGDDCQR
CHPFYQDRPWARATGDSANECLICNCSGRSDQCVFDAEQYRSTGSGGRCLSCRDLTDGPH
CERCRENHYRTSAEEPCLPCICNINGSVSLQCDAEGKCACRTGVTGEKCDKCAAGFHSLG
PAGCRPCECDPSGSVGDCSPSDGGCDCKANVEGQSCGRCKPGFYNLRGVNPEGCQACFCF
GHSLACSSSSHHVVANITSDFLEDQDGWLGEFFGGQSYPLLWKEGEVYLLPLSEDDIGFY
KAPEKFLGRQVYSYGQLLTITFTSETAELLPNNVTLLLQGSDATLTAELSPQPLFSRDPD
LTPRRSFEIRLHEQEGFEPALSAFEFQTFLYNLTDLRISNAGGRNYTSQLTSVTLISAAI
SDKLSGPHARWVESCTCPPGFAGQFCEQCAPGFTRQDPGGGPLSPCVPCNCHQHGTCHQE
TGVCNCSDFTAGKACERCLEGYYGNALIGMPGDCQPCPCPDQSSCAQIVSTGQVVCTNCP
RGQTGMRCQLCEDGYYGDPLGRSGAARPCERCDCNGNVDPNALGVCDHASGRCLKCLGHT
EGHHCERCQRGFYGDALDPTAGKKCKPCSCHPAGTSGDVSECHPQTGRCRCLAHVTGRVC
ASCEVGFFNLQPGVGCERCQCNPVGSSSPACHPITGQCVCRAGVEGTLCHTCRTGFFGFS
SRGCRACNCDPMGSVSMQCHNNGTCRCRRGFVGYKCDKCELNYFHNRATHQCEECPVCYG
LVQKQAEKLRNRLQDLENLLARFDCRSRSGRHLPYPRRPAAEQQREESLPKAREAFIKQF
SSLEASTGRLVAQLHGVTSALNCSLAVTEGGSTRSEASGKAEGVCQSFTEAALVIRRAQK
QLQQATLDLDNMVIPFEMGSEPNQWNMMVNESQVLLQSRRDTAEHIGVVAGSAVNASKQA
LGLLMGLLQDNSTEEYIGNLTERYIKDRKYTKTERPSIAEMQEQTETLAEQTDAAVAEQL
TLEAEAGALRRALRADELLRQTAELHLRLQARDELLVQMEEERRPLEQAARDKEEVLDVA
SEVRRSAVTFLLFHQLQARTHEAKVVALASVVEGKDVESSAMLLRRQLEDMVSEWPRRRA
QTQSALKKERPLENKILASIEKRVSHIQEMLEPAAENSSVSRKVAKEAAETADAVAKESK
DVLTQAKHARTASAHLGSHIDSALQRLVEQEALTGAAHSQITEVLDRPKVSLGAVKEDME
AARLELAAYSDTLTQLINKIDESVPLERFDRILNETARRLRMLRGSVESPHLGRKIQKLH
LAAEEQRSQMSLIDQDLQDIREERDSLRDIASNLPRACPSAE
Download sequence
Identical sequences H2VED0
ENSTRUP00000047575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]