SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000047576 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000047576
Domain Number 1 Region: 619-673
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000363
Family Laminin-type module 0.00084
Further Details:      
 
Domain Number 2 Region: 75-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000184
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 726-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 4 Region: 675-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 5 Region: 521-566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 6 Region: 234-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 187-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 564-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.00089
Further Details:      
 
Domain Number 9 Region: 131-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 10 Region: 774-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000047576
Domain Number - Region: 479-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000047576   Gene: ENSTRUG00000018579   Transcript: ENSTRUT00000047737
Sequence length 1393
Comment pep:known_by_projection scaffold:FUGU4:scaffold_49:1256385:1302546:-1 gene:ENSTRUG00000018579 transcript:ENSTRUT00000047737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISPLTGGNVAFSTLEGRPSAYNFDQSLLLQEWVTATDLLISLDRLNTFGDEFFKDPKVLR
SYFYGISDFSVGGRCKCNGHASECSEGEQGRLLCVCQHHTAGDDCQRCHPFYQDRPWARA
TGDSANECLICNCSGRSDQCVFDAEQYRSTGSGGRCLSCRDLTDGPHCERCRENHYRTSA
EEPCLPCICNINGSVSLQCDAEGKCACRTGVTGEKCDKCAAGFHSLGPAGCRPCECDPSG
SVGDCSPSDGGCDCKANVEGQSCGRCKPGFYNLRGVNPEGCQACFCFGHSLACSSSSHHV
VANITSDFLEDQDGWLGEFFGGQSYPLLWKEGEVYLLPLSEDDIGFYKAPEKFLGRQVYS
YGQLLTITFTSETAELLPNNVTLLLQGSDATLTAELSPQPLFSRDPDLTPRRSFEIRLHE
QEGFEPALSAFEFQTFLYNLTDLRISNAGGRNYTSQLTSVTLISAAISDKLSGPHARWVE
SCTCPPGFAGQFCEQCAPGFTRQDPGGGPLSPCVPCNCHQHGTCHQETGVCNCSDFTAGK
ACERCLEGYYGNALIGMPGDCQPCPCPDQSSCAQIVSTGQVVCTNCPRGQTGMRCQLCED
GYYGDPLGRSGAARPCERCDCNGNVDPNALGVCDHASGRCLKCLGHTEGHHCERCQRGFY
GDALDPTAGKKCKPCSCHPAGTSGDVSECHPQTGRCRCLAHVTGRVCASCEVGFFNLQPG
VGCERCQCNPVGSSSPACHPITGQCVCRAGVEGTLCHTCRTGFFGFSSRGCRACNCDPMG
SVSMQCHNNGTCRCRRGFVGYKCDKCELNYFHNRATHQCEECPVCYGLVQKQAEKLRNRL
QDLENLLARFDCRSRSGRHLPYPRRPAAEQQREESLPKAREAFIKQFSSLEASTGRLVAQ
LHGVTSALNCSLAVTEGGSTRSEASGKAEGVCQSFTEAALVIRRAQKQLQQATLDLDNMV
IPFEMGSEPNQWNMMVNESQVLLQSRRDTAEHIGVVAGSAVNASKQALGLLMGLLQDNST
EEYIGNLTERYIKDRKYTKTERPSIAEMQEQTETLAEQTDAAVAEQLTLEAEAGALRRAL
RADELLRQTAELHLRLQARDELLVQMEEERRPLEQAARDKEEVLDVASEVRRSGLLQLVG
FFGCGSKSVSRTRGKMTDFSDMVSEWPRRRAQTQSALKKERPLENKILASIEKRVSHIQE
MLEPAAENSSVSRKVAKEAAETADAVAKESKDVLTQAKHARTASAHLGSHIDSALQRLVE
QEALTGAAHSQITEVLDRPKVSLGAVKEDMEAARLELAAYSDTLTQLINKIDESVPLERF
DRILNETARRLRMLRGSVESPHLGRKIQKLHLAAEEQRSQMSLIDQDLQDIREERDSLRD
IASNLPRACPSAE
Download sequence
Identical sequences H2VED1
ENSTRUP00000047576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]