SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000047577 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000047577
Domain Number 1 Region: 822-876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family Laminin-type module 0.00084
Further Details:      
 
Domain Number 2 Region: 278-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000022
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 929-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 4 Region: 878-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000218
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 5 Region: 724-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 6 Region: 437-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 390-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 767-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.00089
Further Details:      
 
Domain Number 9 Region: 334-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 10 Region: 977-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000047577
Domain Number - Region: 682-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 93-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0261
Family CBM4/9 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000047577   Gene: ENSTRUG00000018579   Transcript: ENSTRUT00000047738
Sequence length 1597
Comment pep:known_by_projection scaffold:FUGU4:scaffold_49:1256391:1310318:-1 gene:ENSTRUG00000018579 transcript:ENSTRUT00000047738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSMDTTFALGSPVLCFLLALHLSCHLLVRAAMDACYDEEGTPSRCMPKFENIAFNRTVVV
SNVCGSPPEEFCMQTGSTRSCHQCDAADPERSHNAPLLTDFHRNEESTWWQSQSMYFGIQ
HPNSVNLTLHLGKAFEITYVRLKFYTSRPESFAIYKRTQEEGPWLPYQYYSASCKKTYGK
QANAYIRPGDDERSALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSLLLQEWVTATD
LLISLDRLNTFGDEFFKDPKVLRSYFYGISDFSVGGRCKCNGHASECSEGEQGRLLCVCQ
HHTAGDDCQRCHPFYQDRPWARATGDSANECLICNCSGRSDQCVFDAEQYRSTGSGGRCL
SCRDLTDGPHCERCRENHYRTSAEEPCLPCICNINGSVSLQCDAEGKCACRTGVTGEKCD
KCAAGFHSLGPAGCRPCECDPSGSVGDCSPSDGGCDCKANVEGQSCGRCKPGFYNLRGVN
PEGCQACFCFGHSLACSSSSHHVVANITSDFLEDQDGWLGEFFGGQSYPLLWKEGEVYLL
PLSEDDIGFYKAPEKFLGRQVYSYGQLLTITFTSETAELLPNNVTLLLQGSDATLTAELS
PQPLFSRDPDLTPRRSFEIRLHEQEGFEPALSAFEFQTFLYNLTDLRISNAGGRNYTSQL
TSVTLISAAISDKLSGPHARWVESCTCPPGFAGQFCEQCAPGFTRQDPGGGPLSPCVPCN
CHQHGTCHQETGVCNCSDFTAGKACERCLEGYYGNALIGMPGDCQPCPCPDQSSCAQIVS
TGQVVCTNCPRGQTGMRCQLCEDGYYGDPLGRSGAARPCERCDCNGNVDPNALGVCDHAS
GRCLKCLGHTEGHHCERCQRGFYGDALDPTAGKKCKPCSCHPAGTSGDVSECHPQTGRCR
CLAHVTGRVCASCEVGFFNLQPGVGCERCQCNPVGSSSPACHPITGQCVCRAGVEGTLCH
TCRTGFFGFSSRGCRACNCDPMGSVSMQCHNNGTCRCRRGFVGYKCDKCELNYFHNRATH
QCEECPVCYGLVQKQAEKLRNRLQDLENLLARFDCRSRSGRHLPYPRRPAAEQQREESLP
NALEDFLAFQEAREAFIKQFSSLEASTGRLVAQLHGVTSALNCSLAVTEGGSTRSEASGK
AEGVCQSFTEAALVIRRAQKQLQQATLDLDNMVIPFEMGSEPNQWNMMVNESQVLLQSRR
DTAEHIGVVAGSAVNASKQALGLLMGLLQDNSTEDIAEMQEQTETLAEQTDAAVAEQLTL
EAEAGALRRALANVTSSLHRLLPTEAIPDQTNRTGHTNSTGGVSPERHLRGGQTGFGLSV
ERIHAPVTFLLFHQLQARTHEAKVVALASVVEGKDVESSAMLLRRQLEDMVSEWPRRRAQ
TQSALKKERPLENKILASIEKRVSHIQEMLEPAAENSSVSRKVAKEAAETADAVAKESKD
VLTQAKHARTASAHLGSHIDSALQRLVEQEALTGAAHSQITEVLPKVSLGAVKEDMEAAR
LELAAYSDTLTQLINKIDESVPLERFDRILNETARRLRMLRGSVESPHLGRKIQKLHLAA
EEQRSQMSLIDQDLQDIREERDSLRDIASNLPRACPS
Download sequence
Identical sequences H2VED2
ENSTRUP00000047577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]