SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571026826|ref|YP_008898944.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571026826|ref|YP_008898944.1|
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.17e-57
Family ABC transporter ATPase domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571026826|ref|YP_008898944.1|
Sequence length 258
Comment ABC-type high affinity urea uptake system ATPase component UrtD [Thermosynechococcus sp. NK55]
Sequence
MTPILEIEDLTVSFDGFNALNHLSFQMQAGELRVIIGPNGAGKTTFLDVITGKVKPTQGR
VLFKGRNLRRYSEDQIARMGIGRKFQTPRVYLNLTVQENLELAVARRKSVLAMLFQPLSR
EERDRLHSLIDTIDTIGLRPKANFPAGLLSHGEKQWLEIGMLVAQSPDLLLVDEPVAGLT
DEETHLTGELLVALAESHSIIVIEHDMEFVRQIARTVTVLHEGSVLCEGSIETVQNDPRV
IEVYLGAPLEESDLAQQP
Download sequence
Identical sequences V5V1Z5
WP_024123852.1.87165 gi|571026826|ref|YP_008898944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]