SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571026898|ref|YP_008899016.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571026898|ref|YP_008899016.1|
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.96e-30
Family Ribosomal L11/L12e N-terminal domain 0.000076
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.49e-28
Family Ribosomal protein L11, C-terminal domain 0.0000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571026898|ref|YP_008899016.1|
Sequence length 141
Comment 50S ribosomal protein L11 RplK [Thermosynechococcus sp. NK55]
Sequence
MAKKVVAVIKLAIQAGKANPAPPIGPALGQHGVNIMMFCKEYNARTADQVGMVVPVEISV
YEDRSFTFVLKTPPASVLIQKAAGIEKGSGEPNKKKVGSITRAQLREIAEKKMPDLNAND
IEAAMRIIEGTARNMGVTITD
Download sequence
Identical sequences Q8DM28 V5V2A0
NP_681086.1.97157 WP_011056150.1.87165 197221.tlr0295 gi|22297839|ref|NP_681086.1| gi|571026898|ref|YP_008899016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]