SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571026933|ref|YP_008899051.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571026933|ref|YP_008899051.1|
Domain Number 1 Region: 14-206,307-397
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.29e-88
Family Bacterial dinuclear zinc exopeptidases 0.0000228
Further Details:      
 
Domain Number 2 Region: 194-305
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 6.02e-31
Family Bacterial exopeptidase dimerisation domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571026933|ref|YP_008899051.1|
Sequence length 402
Comment N-acyl-L-aminoacyl hydrolase Ama [Thermosynechococcus sp. NK55]
Sequence
MAFHLPQVSCQLRPEVAALQPELVQWRRYLHQRPELGFQEHLTAAFVSEKLRQWGIQHRT
GIAETGIVAVLPGSRPGPVLAIRADMDALPIQEENDKPYRSLHEGKMHACGHDGHTAIAL
GTAKYLATHRDFAGTVKIIFQPAEEGPGGAKPMIEAGVLDTPKVDGIIGLHLWNFLPVGT
VGVRSGPLMAAAEFFECEVHGKGGHAALPQFTVDTVLVVAQIITALHTIVSRNVDPLETA
VISVGAVHAGTAKNVIADTATFRGTVRYFKPELGDWLPQRIEQVIAGICQSHGATYRFHY
ERMYPPTVNDAKMAKLVRSVAESVVEVPAGVTSHCQTMAAEDMSFFLKAVPGCYFFLGSA
NGTLGLDFPHHHPRFDFDEIVLSIGVELFVRCVEKYCGLVET
Download sequence
Identical sequences V5V2D2
gi|571026933|ref|YP_008899051.1| WP_024123957.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]