SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027098|ref|YP_008899216.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027098|ref|YP_008899216.1|
Domain Number 1 Region: 134-268
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 5.11e-44
Family 6-pyruvoyl tetrahydropterin synthase 0.0000632
Further Details:      
 
Domain Number 2 Region: 3-131
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 8.89e-39
Family 6-pyruvoyl tetrahydropterin synthase 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027098|ref|YP_008899216.1|
Sequence length 290
Comment 6-pyruvoyl tetrahydrobiopterin synthase QueD [Thermosynechococcus sp. NK55]
Sequence
MDCIIHRRAEFAASHRYWLPEWSDVENRARFGGNSYFPGHGHNYELIVSIRGTVDDFGMV
LNLSEVKHVIRREVIEPLNFSYLNEVWPEFQATLPTTEHIARVIWDRLFPHLPLVRIRLF
EHPRLWADYTGDPMEAYLSVGTHFSAAHRLALQDLSYEENCRIYGKCARPHGHGHNYHVE
ITVKGSIHPRTGMVVDLVKLEEVLREQVIEPLDHTFLNEDIPYFATVVPTAENIAIYIAQ
LLQEPIRQLGATLHRVKLIESPNNACEILCEELPPRNEGISAALPVLERA
Download sequence
Identical sequences V5V2T2
WP_024124120.1.87165 gi|571027098|ref|YP_008899216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]