SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027304|ref|YP_008899422.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571027304|ref|YP_008899422.1|
Domain Number - Region: 58-147
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000121
Family Flavin-binding PAS domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027304|ref|YP_008899422.1|
Sequence length 154
Comment signal transduction protein with MEKHLA (PAS) sensory domain [Thermosynechococcus sp. NK55]
Sequence
MEPWLQPAALRQARRICVSFQRWTGRSLLPNPAEDDWSLGQQLFDWSQPVLSHGSEADPI
LNYGNQAALTLWEYLWTEWVQLPSRFTAEPMAQAERSTLLAQAARQGYTSHYSGIRISRT
GRRFRIENACIWTVLDEAGNPVGQAATFDHWRFL
Download sequence
Identical sequences V5V2Y1
gi|571027304|ref|YP_008899422.1| WP_024124320.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]