SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027463|ref|YP_008899581.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027463|ref|YP_008899581.1|
Domain Number 1 Region: 424-599
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.65e-55
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027463|ref|YP_008899581.1|
Sequence length 601
Comment N-acetylmuramoyl-L-alanine amidase AmiA [Thermosynechococcus sp. NK55]
Sequence
MEQPWHSWQFRAVVSCLWAPTAAWVMAQPATARDLQLWRLNPATNQLEIRTERAVQPRAE
LVYNPTRLVIDLPGVVLGSPPISQNYGGAIRQVRVAQFDPQTTRIVVEYAAGFTIDPQQV
RFRGVTANNWLVQLPTPQQQPVSLPTPPPPSSPSTPSVPPTEPLQIRSWRADGIGFLVFA
DRPLAEGSYTIRRPWRDRMEILLSNSELIRNFSPRRLELRRFGGDRIRAEIRAQSNRQVQ
ITLDIDAQDADWQVTPRHDGFVIVPSSTAITPPTAPPRPQRPSVIPAASAQTPVTTIQRV
DLGGRELLIQGDRTVFYSVGWEGNRYRIRLRQAQLDGNLREPRVVTGSPLSNIEFRQEDD
QTVSILLTPAPNFRILGPRPLSAESFVVQIQGVNDSPTSAPTPIDIPPTTKTQPPSQPVP
RGRFVVVIDPGHGGSDPGAIGIGGIREKDIVLDISLQVSQFLQQQGVQVIMTRTTDIDLD
LAPRVAIAERARANAFVSIHANAIGIARSDVSGLETYFAPGRSSRLAVAIHNSILSSLNI
RDRGVRSARFYVIRNTSMDSTLVETGFVTGAEDAANFQNPTWRTQMARAIAQGILNFLNG
R
Download sequence
Identical sequences V5V3U6
gi|571027463|ref|YP_008899581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]