SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027516|ref|YP_008899634.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027516|ref|YP_008899634.1|
Domain Number 1 Region: 308-357,387-619
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.17e-26
Family Tandem AAA-ATPase domain 0.034
Further Details:      
 
Weak hits

Sequence:  gi|571027516|ref|YP_008899634.1|
Domain Number - Region: 35-170
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000398
Family PDEase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027516|ref|YP_008899634.1|
Sequence length 761
Comment type I CRISPR immunity system helicase Cas3 [Thermosynechococcus sp. NK55]
Sequence
MPPRFTPPKLEPDILLAKSSLPGNPDWGEDHDLVGHTAAVVKSITTLVHSLGSNLLQQFG
LGDRHSSFATLEATARLAAYLHDWGKANHQFQGVVRYSLIGSNPSVSPQRNPLERPQLIR
HEVGSVLLAWEFREWLVQCPNADFMTAIAAAGGHHLKLGGKDGKDTGKLVEVREGSGDTC
LHWYVKHPYFCKLIHYGVRTLGLPQDLPLSQFSQQWEIKTIKDKGEKVLDAFIDEWEPDA
AFVAVVKALLVAADAIASASGQMAISLQQWIEDVLKQTLTEADLQTVINTRLCGHSLRPF
QTDLANTPQRVTLARAGCGSGKTLGAYCWAQKHAIGRKLFFCYPTTGTSTEGFLGYVHNK
VESELLHSRSAVDLELACTGEEVNNGDGSVNETAQKLEAFKAWDAKVNICTVDTVLGLLQ
CHRRPLYCFPAIANAAFVFDEVHCYDEALFGALLRFLKVVKAPILLMSASFLPTQVEAIK
EAVGEPVEVVQGPQELEDLPRYRFHQLTEPDWEWVQQELAKGGKVLWVCNQVDTAIAVYQ
QAKARGLRPFLYHSRFRYGDRVDRHRAVVDAFKQDQPILAITTQVAEMSLDLSATLLVSQ
IADPAGLIQRLGRLNRQYCGHPRDALFYPDEKTGFPYSQDQLKAGEALIQKFAAQEVSQR
QLAAWLENLNIQHTPKDHFVWLDGKWKTYPAPLRKAGYTVTALLEQDQPTVAQLKWSELA
RYTVPLPANNIQGWQRHRRGYLIAPQEQWGYDSELGAFALK
Download sequence
Identical sequences V5V425
WP_024124530.1.87165 gi|571027516|ref|YP_008899634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]