SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027645|ref|YP_008899763.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027645|ref|YP_008899763.1|
Domain Number 1 Region: 12-232
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.65e-56
Family PP-loop ATPase 0.00018
Further Details:      
 
Domain Number 2 Region: 212-316
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 3.14e-19
Family MesJ substrate recognition domain-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027645|ref|YP_008899763.1|
Sequence length 344
Comment tRNA(Ile) lysidine synthetase TilS [Thermosynechococcus sp. NK55]
Sequence
MWGIHHARLHTTLKIQQWLPLGSRILIALSGGQDSVCLTRLLLDLQPHWQWFLAAVHCDH
RWRADSTANANFVRQLAQKWHLPCEVVSAPDLPKTEAAARSWRYQVFEIMAKALDCTHVV
TAHTQSDRAESLLLHLLRGTSPDGLATLLPSRSLGAIQLVRPLLGMTRAETAAFCQAYGL
PIWQDETNHNVAYRRNRLRLELIPYLQQHFNPNLEEVLGQTAELLASDRAYFEAEVERLA
PTVIREHPPALDRLRLRELPLALQRRLIQRFLRQHLKRGLNFRVIEAVRALITAGNGSQT
ASLPGGKHLRVCGRWIELVRPMPPPPAPVPPGQGGRSPPPSPLY
Download sequence
Identical sequences V5V4C7
WP_024124652.1.87165 gi|571027645|ref|YP_008899763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]