SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027722|ref|YP_008899840.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027722|ref|YP_008899840.1|
Domain Number 1 Region: 352-546
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.57e-51
Family Ppx associated domain 0.0026
Further Details:      
 
Domain Number 2 Region: 156-338
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.14e-42
Family Ppx/GppA phosphatase 0.00065
Further Details:      
 
Domain Number 3 Region: 29-152
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.1e-37
Family Ppx/GppA phosphatase 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027722|ref|YP_008899840.1|
Sequence length 560
Comment exopolyphosphatase PpxA [Thermosynechococcus sp. NK55]
Sequence
MFVPLMTTPMTAEQHLHLWRPVNLSDRILAAIDVGTNSIHMVVVQIQPSLPSFKIIATEK
DMVRLGERCQITGQLTEEAMQRAIATLRRCRELATGLKAEEMIGVATSAVREAPNGREFL
ERVKKETGLTIDLISGEEEARRIYLGVLSGLEFNGKPHIIIDIGGGSTELILGDGHEPRC
LSSTKVGAVRLTDLFVKSDPISDQDYIALRAYVRGMLDRAVEDLRQQLGPHEKPQLVGTS
GTIESLMMIHTCDRLGTCPPSLRGYELTLEDLKALLAKLRRLNFNQRCQLLGMSERRAEI
IVAGAVILAEAMEMLGQSSLITCDRALREGIIVDWMLTHGLIEDRLRYQSSVRQRSTYSL
AQKFHVNLASSERVANFALTLFDRTQGILHNWTEAERELLWAAAILHNAGHYVSHSAHHK
HSYYLVRHGGLLGYTDTEIEIIANLCRYHRKSPPKKKHENFRQLMGRRERQMVEQLSAIL
RLASALDRRQIGAVDHITCEWRAPQRQFCLQIHPADPSDRCELEIWSVNYKKEPFESQFS
VSLKVELVAARGTVLATAVN
Download sequence
Identical sequences V5V653
gi|571027722|ref|YP_008899840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]