SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027728|ref|YP_008899846.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027728|ref|YP_008899846.1|
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.4e-48
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00001
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 4.47e-20
Family TS-N domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571027728|ref|YP_008899846.1|
Sequence length 341
Comment elongation factor Tsf [Thermosynechococcus sp. NK55]
Sequence
MAEISAKLVKELRDKTGAGMMDCKKALQESNGDMEAAIAWLRQKGLASAGKKAGRLTSEG
LVDSYIHTGGRIGVLVEVNCETDFVARNEKFKTLVQDIAKQIAACPNVEFVSLDDIPAEY
KEKERQIALGSDALKGKPPEVQEKIVAGKLEKTLKELCLLYQPFIRDQSKTVEELVKEHI
AELGENIQIRRFQRFVLGEGIEKQETNLAEEVAAQTQAMSAAAKTAEATAEVAETAPPEV
SAPEPAAEVTTEEPAPEPVAAAEQTAEPAAESKGFGAATKKSGGKSRPNKKKNKAPRRSH
GFGETQGQFRYSLRLRRFGAGETCGYICPVDPPLGSPHRQP
Download sequence
Identical sequences V5V4J8
gi|571027728|ref|YP_008899846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]