SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027785|ref|YP_008899903.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027785|ref|YP_008899903.1|
Domain Number 1 Region: 178-494
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.29e-117
Family Leucine aminopeptidase, C-terminal domain 0.000000408
Further Details:      
 
Domain Number 2 Region: 1-181
Classification Level Classification E-value
Superfamily Macro domain-like 4.06e-37
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027785|ref|YP_008899903.1|
Sequence length 497
Comment cytosol aminopeptidase PepA [Thermosynechococcus sp. NK55]
Sequence
MQLQTVTTAIPDWSGDLLAIAVFQTEGTLTLTDPYTTLDQRLNGLLQELINEGEFQGKSG
TSLLMRLLPNFPLKKLLLVGLGNREEFNLEALRRTGATIARTARRERAKTLGIALPHETL
EAADAAQAVAEGVILALHSDVRFKTDPEARKLLPYPEVVTLLGLGEQTAALTRAQRICDG
VILARELVNAPANEVTPVTLAETAQQLAATYGLRAKILERDECAALGMGAFLGVAQASDL
PPKFIHLTYTPLGNVQKKIALIGKGLTFDSGGLNLKTQGGIETMKMDMGGAAAVLGTAKV
IGQLKPAGIEVHFIIAATENMISGRALHPGDILTASNGKTIEVNNTDAEGRLTLADALVY
AEKLGVDAIVDLATLTGACIVALGDNIAGLWSNNAELAQALQKASDRCGEKFWQMPLENK
YFEAMKSQVADMKNTGPRSAGSITAALFLQQFVDHTPWAHLDIAGPVWTEKEDGYNNPCG
TGYPVRTLVEWLCSLSA
Download sequence
Identical sequences V5V4S5
gi|571027785|ref|YP_008899903.1| WP_024124791.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]