SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027834|ref|YP_008899952.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027834|ref|YP_008899952.1|
Domain Number 1 Region: 5-191
Classification Level Classification E-value
Superfamily ITPase-like 3.4e-61
Family ITPase (Ham1) 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571027834|ref|YP_008899952.1|
Sequence length 194
Comment non-canonical purine NTP pyrophosphatase RdgB [Thermosynechococcus sp. NK55]
Sequence
MPILAQAVLASHNAGKVKEFQGWLQPWIGELLALPVTIEIAETADSFVGNACLKAATAAK
QMGQWAIADDSGLAVHALQGAPGIYSARYGATDAERIERLLREMADVSDRAAEFICVIAL
ARPDGTIAVTTEGRCAGEILTAPRGQGGFGYDPVFWVPSQQRTFAEMSPVEKQQVSHRGQ
ALQRLREYFQTFNP
Download sequence
Identical sequences V5V4E7
gi|571027834|ref|YP_008899952.1| WP_024124837.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]