SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027897|ref|YP_008900015.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571027897|ref|YP_008900015.1|
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00329
Family Transcriptional factor domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027897|ref|YP_008900015.1|
Sequence length 162
Comment deoxyribonucleotide-responsive transcriptional repressor of deoxyribonucleotide biosynthesis NrdR [Thermosynechococcus sp. NK55]
Sequence
MQCPYCHHTDSRVLESRSAEGGQSIRRRRECLACGRRFTTYERIEFVPITVIKRNGDRES
FDRSKLLRGIMTACGKTNIPQQKIEALVDDIEADLQLRSRREVTSTELGEAALQRLRHLS
EVAYVRFASVYRQFQGISDFVAELAHLQETSDSPELLTASQP
Download sequence
Identical sequences V5V6Q1
gi|571027897|ref|YP_008900015.1| WP_024124897.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]