SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028203|ref|YP_008900323.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028203|ref|YP_008900323.1|
Domain Number 1 Region: 346-501
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.16e-17
Family HD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571028203|ref|YP_008900323.1|
Sequence length 727
Comment glycyl-tRNA synthetase beta subunit GlyS [Thermosynechococcus sp. NK55]
Sequence
MPQSSLHTFLLEVGTEDLPARFVSSALRQWRTLIPQTLKERGLTAEVNVWATPRRLAVLI
EGLPPQQPDQAIEIKGPAATVAFREGEPTPALLGFLRSRQGSLEEIEIRATEKGEVVYLK
QIRPGQPTPQLLTELAQQWIAALEGPRFMRWGDGDLRFSRPIRWLVLLWDEQVLPLVLES
HSVSIASDRTTYGHRVLSQGAIALSHAQDYASALEKAGVLVDPEARQQRIREQIAALAAE
AAGWVDLEVPLLEEVTHLVEWPTAVLGSFEARFLALPLEVITTVLVSHQRYFPVYTDATR
QALLPVFITISNGDPAATSLIRAGNERVIRARLADAEFFYRADTAQPLEHYCGKLATVTF
QDELGSMADKVKRLTALARQIATALNCAAADIAAIERTACLCKADLVTQMVGEFPELQGY
MGQVYARVSGEAPAVAMGIFEHYLPRFAGDRLPQSLTGQVVGLADRLDTLVCLFGLGLCP
TGSSDPFALRRAANGVITILWQGEHHLNLLALLQEYAQAFCRQFAAKLSAADLEQQLRQF
FSQRLRTLLQEDLGIEYDLVNAVIPEDQPELQTRALQDVVDARDRAQFLQKLRQSGDLMA
IYPTVNRAARLARQGTLGTDCLNIRAVKAKHLEAPIEKEFYSALKDILPTVQQAQGQRAY
GQIVDALVSLAPIVSRFFDGEESVLVMAEDATVRANRLALLGLLRNCAAIIGDFGAIVQT
ESVPSAP
Download sequence
Identical sequences V5V5Z6
WP_024125199.1.87165 gi|571028203|ref|YP_008900323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]