SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028280|ref|YP_008900400.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|571028280|ref|YP_008900400.1|
Domain Number - Region: 56-141
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 0.0667
Family Prokaryotic type I DNA topoisomerase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571028280|ref|YP_008900400.1|
Sequence length 414
Comment transmembrane protein of unknown function DUF445 [Thermosynechococcus sp. NK55]
Sequence
MAEISYWTLLVPPLAGGVIGYFTNDLAITMLFRPYKPVYVGGKQLPFTPGLIPRNQERLA
RRIADAILGSLLTPEELQNLARRLLQVQRVKAVIHWLLQTSLSQIQAQSEQRSAQVLANI
LRDFFGSALPRLIKVWSRREDFLEPQLNQLFDQVLVELQLNDEQAEKLADWLLSVMLPPD
RLRLAIIDFLTDRTINVLDQELRQNTSGTYWVVANLVGVRNTLIRLREYCLNEREACNRR
LGELITALALRQRLVEALQNITLQSLPLGTVRELRQLFRQTVRSYIQEQGSSVIETVSQT
VEWETISLSILRRLRDSASLGASLEVVSDELALVLDRYLERDMELIIERAIPILDLDRVI
VDRVKATSPENLELAIQGIVRSELQAIVRLGGILGFLIGVVQAGFLYWQSLQVP
Download sequence
Identical sequences V5V7Q9
WP_024125276.1.87165 gi|571028280|ref|YP_008900400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]