SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028363|ref|YP_008900483.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028363|ref|YP_008900483.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000776
Family 7-Fe ferredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571028363|ref|YP_008900483.1|
Sequence length 75
Comment 4Fe-4S type iron-sulfur protein [Thermosynechococcus sp. NK55]
Sequence
MAHTIVTNTCEGVADCVEACPVACIHPGPGKNSKGTDWFWIDFATCIDCGICLQVCPVEG
AIVPEERPDLQATPA
Download sequence
Identical sequences V5V6H5
gi|571028363|ref|YP_008900483.1| WP_024125357.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]