SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028380|ref|YP_008900500.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028380|ref|YP_008900500.1|
Domain Number 1 Region: 20-209
Classification Level Classification E-value
Superfamily GAF domain-like 8.72e-30
Family GAF domain 0.0006
Further Details:      
 
Domain Number 2 Region: 413-526
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000907
Family HD domain 0.043
Further Details:      
 
Domain Number 3 Region: 203-304
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000885
Family HD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571028380|ref|YP_008900500.1|
Sequence length 537
Comment metal-dependent phosphohydrolase with GAF domain [Thermosynechococcus sp. NK55]
Sequence
MILSPFERAVLGQEAEALVDQLLEIGIALSASQSLEELLHLILTKSRQITASDAGTIFLV
QRERAVLEFKAAQNDSVTLPEQVQDYTVPLTADSLVGYAALTGESLNIADVYALKGSEMY
QFNRSFDEALHYRTCSVLVVPMQNVSGEVIGVLQLINRKRSPDTLLTPETSVALTQPYSP
WEEHIVRSLASQAAVIIERNHLLESIEQLFEGFITASVQAIETRDPVTAGHSERVAALTV
RLAEITSATSRGVFRDVFFSDRQLQEIRYAALLHDFGKVGVPEAILNKQKKIYPEQLEVI
RQRFALVRRTLEMETAQAKVNYLLSHPHQLHTPEQGCQHCAFLRQLDQELQQQLHTLENY
WQLLEQANEPRILEEEPLARLQELTQFYYRGVDGELHPLITATELEQLLVRRGNLTQQER
RIIEAHVTYTYQFLARIPWTPHLKNVPIIAYGHHERLDGSGYPRGIGAAEIPLQTQMLAI
ADIYDALTAKDRPYKKSLPVNKALEVLWQEAKEFKINPDLVELFEQQEVFRVLGHQR
Download sequence
Identical sequences V5V827
gi|571028380|ref|YP_008900500.1| WP_024125372.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]