SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028537|ref|YP_008900657.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028537|ref|YP_008900657.1|
Domain Number 1 Region: 5-199,300-389
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1e-83
Family Bacterial dinuclear zinc exopeptidases 0.0000217
Further Details:      
 
Domain Number 2 Region: 187-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.7e-30
Family Bacterial exopeptidase dimerisation domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571028537|ref|YP_008900657.1|
Sequence length 393
Comment N-acyl-L-amino acid amidohydrolase Ama [Thermosynechococcus sp. NK55]
Sequence
MLARIRQITQTLTPRLIEIRRHLHRYPELSGQEHQTAAYVAGVLSSVGLTVQQDVGKVGV
IAELEGNPQEQRLLAIRTDMDALPIQERTGLEFSSKHTGVMHACGHDVHTTVGLGTAMVL
AALKEEFPGRVRFIFQPAEEIAQGASWMIADGAMKEVSAILSLHVFPSIPAGDVAVRYGA
LTAAADDIELTILGESGHGARPHEAVDAIWIAAQVISALQQAISRTQNPLRPVVLTFGKI
QGGRAANVIADQVTLQGTVRSLHPETRATLPTWIEQIVANVCHAYGARYQLHYRRGVPGV
ENTPYLSQLLAEAATDVVGAPHVHILPEPSLGAEDFALYLEHAPGAMFRLGVGFRDRPNY
PLHHPEFDVDEQAIPVGVMTLAHAACRYWQIPY
Download sequence
Identical sequences V5V6E4
WP_024125528.1.87165 gi|571028537|ref|YP_008900657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]