SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028706|ref|YP_008900826.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028706|ref|YP_008900826.1|
Domain Number 1 Region: 13-223
Classification Level Classification E-value
Superfamily ARM repeat 2.23e-34
Family PBS lyase HEAT-like repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571028706|ref|YP_008900826.1|
Sequence length 228
Comment phycocyanin alpha phycocyanobilin lyase related protein NblB [Thermosynechococcus sp. NK55]
Sequence
MENLGVDTGAIHELITSADVGDRLRGINQLRSLDPKDAFALIQPLSKDDNARVRYAAVSQ
IASLGHINLNQAHDLLRDRLLHDSETDVRAAAADAMAALQVPFALEDLETAYHSTNDWLL
QFSIIAALGALGNPAAVGLLTEALNSPQELVKLAAIGSLGELKQPESIEHLRPFVAYPDW
QVRHRLAIALGQIGTLEVRPLLEQLATDSAAAVAEAARSSLAQLTTQH
Download sequence
Identical sequences V5V7D0
WP_024125691.1.87165 gi|571028706|ref|YP_008900826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]