SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571028819|ref|YP_008900939.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571028819|ref|YP_008900939.1|
Domain Number 1 Region: 13-193
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.26e-35
Family Zn metallo-beta-lactamase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|571028819|ref|YP_008900939.1|
Sequence length 224
Comment hypothetical protein NK55_10935 [Thermosynechococcus sp. NK55]
Sequence
MIWIPVAQQQKLPRLVLPRVYGFPPNRETLGGTAYLIVENDGNTLIDAPFWTDTTQDWLR
AQGGVQRLILTHRGAIARVREIQHTFNCEVIIHEQEAYLLPQVTVTPFNHHLAIGETLEI
LWTPGHSPGSACVYWSCQGGVLFTGRHLLPTPTGELAPIKTATTFHWPRQLRSVEALKAF
CRQKCLSYLCPGANIGFLRGTLAIANAQAVLQGLSVDNLLSNKF
Download sequence
Identical sequences V5V7U3
WP_024125802.1.87165 gi|571028819|ref|YP_008900939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]