SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571029002|ref|YP_008901122.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571029002|ref|YP_008901122.1|
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.96e-73
Family HD domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 184-400
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.54e-64
Family RelA/SpoT domain 0.0000284
Further Details:      
 
Domain Number 3 Region: 384-455
Classification Level Classification E-value
Superfamily TGS-like 7.52e-25
Family G domain-linked domain 0.054
Further Details:      
 
Domain Number 4 Region: 650-728
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000000199
Family AF1403 N-terminal domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571029002|ref|YP_008901122.1|
Sequence length 736
Comment bifunctional GTP pyrophosphokinase/ guanosine-3',5'-bisdiphosphate 3'-pyrophosphohydrolase [Thermosynechococcus sp. NK55]
Sequence
MPTDIELPDWLATCLQNPNPENGDDLVCRAFQFAYDLHQGQRRASGEPYIAHPVAVASIL
RDLGGGPALLAAGLLHDVIEDTAVTAEELEANFGAEVRRLVEGVTKLSKFNFSSKTERQA
ESFRRMFLAMAQDIRVIVVKLADRLHNMRTLEYLPEDRRHAIAQETRDVFAPLANRLGIW
RIKWELEDLAFKYLEPEAYRRIQELVAEKRANREAQLQQAIQILQERLSGMGFGYLEISG
RPKHLYSIYQKMMRQHKEFHEIYDIAGIRILVATKDECYRALAVVHDCFLSVPGRFKDYI
SLPKPNQYQSLHTVVMGLGGRPLEVQIRTLAMHHVSEYGIAAHWKYKETGQSLPQQWSVQ
DQKFTWLRQLLDWQNDLKDAQEYLDSIRDDLFDKEVYVFTPQGDVLALQQGATPLDFAYR
IHTDIGNHCAGARVNGRMVPLDTPLRNGDIVEILTQKTAHPSLDWLNFVKTTTARNRIRQ
WYKRSRRDENLQRGRELLEKELGKAGLEALLKSPQMQQVAERSNYQSVDDLVAALGYGEI
TLNLVVNRLRAITLARPETTPPELPSESAPVNRVPATTKPTDSPILGVEGLVYHIAGCCC
PVPDEPIIGVVTLGSRGISIHRQGCSSLEAVSSDRLIPVSWNTKVNPHRPQTYPVDVQIE
VIDRVGILKDILTRLTDHQINVRRANVHTHPTGTATIDLCIDIVNAKQLDRILAQIRKIT
DVLNIRRRQPTEVSSP
Download sequence
Identical sequences V5V7S1
gi|571029002|ref|YP_008901122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]