SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571027368|ref|YP_008899486.1| from Thermosynechococcus sp. NK55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571027368|ref|YP_008899486.1|
Domain Number 1 Region: 27-319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.73e-58
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 404-501
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.49e-29
Family Pentapeptide repeats 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571027368|ref|YP_008899486.1|
Sequence length 524
Comment serine/threonine protein kinase regulator of Mn uptake SpkB [Thermosynechococcus sp. NK55]
Sequence
MSYCLNPNCTKPDNPDNVDVCQACGSKLLLNNQYKAIKVLGRGGFGATFLAIDTQLPGNP
TCVIKQLRPAATAPHIIAMARELFLREATTLGKVGNHPQLPRLLGYFENENEFYLIQEYV
GGLTLQQEVKRFGPKSEEEVKQVLQEVLPILDYLHTNGVIHRDIKPANLIRRDIDNKLVL
IDFGAVKDKVTQAMVENAPELSTFTNFAVGTPMYAPPEQMAMRPVYASDIYALGVTCVYL
LTAKSPKEIERDPRTGEWHWQRYVKNISPAFAALLNKMLQDAVKDRYQTAMDVLADLQLL
ESKQPASVAAPTVSAEDDDLSNALSTPPTQGRPRVPEAPKRSSYASSVSQNAQAARVRQS
RMTGTQLGGPPVVGTGPGQHLRAKVTPRMTAAQVLTAYKRGERDFIDVDLSNVVLRNADL
AGANFANANFTNADLKGCILANAVLREANFQGANLNDANLCGAYLVQANFERANLKGAKL
LDASISGANFTGADISGADFSMVSGFVQGQLDRAKKNWFTKLPK
Download sequence
Identical sequences V5V3K6
WP_024124384.1.87165 gi|571027368|ref|YP_008899486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]