SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000000330 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000000330
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily E set domains 2.13e-58
Family Arrestin/Vps26-like 0.00000088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000000330   Gene: ENSTRUG00000000165   Transcript: ENSTRUT00000000333
Sequence length 152
Comment pep:novel scaffold:FUGU4:scaffold_2476:11417:12741:1 gene:ENSTRUG00000000165 transcript:ENSTRUT00000000333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVFKKASPNGKLTVYLGKRDFMDQVDQVEPVDGVILIEPEYLKARKVFVTLTCAFRYGRE
DLDVLGLTFRKDLFVANSQVFPPSAEPETRLTLLQERLMKKLGEHAHPFTFQIPLNLPCS
VTLQPGPEDTGKKIINGTSGFSGKLKEKSVKK
Download sequence
Identical sequences H2RJL7
ENSTRUP00000000330 31033.ENSTRUP00000000330 ENSTRUP00000000330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]