SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000000619 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000000619
Domain Number 1 Region: 43-259
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-63
Family SPRY domain 0.0000000215
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000000619
Domain Number - Region: 248-285
Classification Level Classification E-value
Superfamily SOCS box-like 0.000173
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000000619   Gene: ENSTRUG00000000282   Transcript: ENSTRUT00000000622
Sequence length 286
Comment pep:novel scaffold:FUGU4:scaffold_214:86045:98952:1 gene:ENSTRUG00000000282 transcript:ENSTRUT00000000622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISSGIKSVEGRGDSGGSPSYRPSAHRRHHPELREPDFSKPARLDLLLDMPCAGLET
QLRHAWNPDDRSLNIFIKEEDKLTFHRHPVAQSTDCIRGRVGYTRGLHVWKIHWPARQRG
THAVVGVATLEAPLHSVGYTALVGSDCESWGWDLGRHRLYHDSKNRAHSSLPSYPSFLEP
EDSFSLPDSLLVILDMDEGTLSFMVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEISMKYI
NGLDPEPLPLMDLCRRAARLALGRDRLQEIESLPLPQSLKNYLQYQ
Download sequence
Identical sequences H2RKF6
31033.ENSTRUP00000000619 ENSTRUP00000000619 XP_003975718.1.43653 ENSTRUP00000000619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]