SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000000788 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTRUP00000000788
Domain Number - Region: 96-161
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00864
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number - Region: 11-81
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0785
Family Coiled-coil dimerization domain from cortexillin I 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000000788   Gene: ENSTRUG00000000343   Transcript: ENSTRUT00000000791
Sequence length 188
Comment pep:novel scaffold:FUGU4:scaffold_175:91265:93537:-1 gene:ENSTRUG00000000343 transcript:ENSTRUT00000000791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMDRQLEMDSLEMRLQVLENRIYGEKRSKSAKPIKCAESLAKIQAGLINTGNKRERVKIL
HKKIEDLLKYLDPQFTDHITLPDAMKLEFILAEEAFLFSHAALLEQISNMQPLLDSSYIR
DVPEHATKLQRLSQIHVRQQDQMEAQSQEVKKLFEEYNKMMFLLSKQFTQWDQSLRKIEE
AKGIRPVE
Download sequence
Identical sequences H2RKX5
31033.ENSTRUP00000000788 ENSTRUP00000000788 ENSTRUP00000000788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]