SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000001728 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000001728
Domain Number 1 Region: 35-245
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-19
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000001728
Domain Number - Region: 231-302
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0493
Family G proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000001728   Gene: ENSTRUG00000000719   Transcript: ENSTRUT00000001736
Sequence length 653
Comment pep:novel scaffold:FUGU4:scaffold_511:71037:75205:-1 gene:ENSTRUG00000000719 transcript:ENSTRUT00000001736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYNISRLFEAVARRDVDDLANLHQYLHRNMKNLSDSLCEDQSYGKSALMKALLHLKDGKN
ETVEWLIHISEEMGDLKTFVNLAYTSAYYKGQTALHVAIERRSLSYVKLLVSKGADVHAK
ASGTFFQPHSGPSFYFGELPLSLAACTNQPAMVDFLMDNKYQPTDPNKKDSHGNTVLHAL
VAVADNSEENTKFITSMYDHILVMVARLYPKLKLEDIQNNNGLTPLTMATKTGKSGLFSH
ILKREFQENDTKHLSRKFTEWVYGPVTCSLYDLASVDSYQKNSALEILVYGSNVPNRHEM
LQTAPLGQLLESKWKKFAGHMFCLNFLFYLVYLIVFTAVAYNKNEGQWMNRIEHTFLGYT
YISGQLFTALANCYFFIIGILDMRRKRPKLQTLLIDGYYEILFLFQGTLFMISAGLYLME
REEFLGFLVVCLALSWVNLLYFSRGDKHMGIYSIMIQKMILGDILRFLFVYAVFLFGFSA
AVVTLLIEPPAKNITINERGRLFGPISNGAECVKPTYRNISYTTLQLFKFTIGMGDMEFT
EHYKYKEVFYVLLIGYIILTYILLLNMLIALMNRTVEKTTMESTSIWQLQRAFTIMDMER
RIPYCLKSWFRCGVKKNLGSGWGDDHRWCFRVEEVNWNKWNIHLSKIDEDPGC
Download sequence
Identical sequences H2RNL5
ENSTRUP00000001728 31033.ENSTRUP00000001728 ENSTRUP00000001728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]