SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002264 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002264
Domain Number 1 Region: 51-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.64e-26
Family G proteins 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002264   Gene: ENSTRUG00000000958   Transcript: ENSTRUT00000002274
Sequence length 219
Comment pep:novel scaffold:FUGU4:scaffold_51:425981:430276:1 gene:ENSTRUG00000000958 transcript:ENSTRUT00000002274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLRHISVALTAAVAALGSALFIALNFFYKVRRSRRQQCLSVSPQEEEDRGKRQVLVLG
LDGAGKSSMLQGLNAGESAAKRGRCRPTRGFNFMSLNVPACQLDFLEIGGGEDLRPYWSD
YLKRTHILVYVVDSSDRSRLPLAKAELHRLLRVEPQLPVVVLGNKQDKSDALGMSELQEA
LSLGSLADDRKLFLLAAQLGSDGSARNSHQGLDTFQDLL
Download sequence
Identical sequences H2RQ49
ENSTRUP00000002264 ENSTRUP00000002264 31033.ENSTRUP00000002264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]