SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002472 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002472
Domain Number 1 Region: 362-523
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.03e-31
Family ABC transporter ATPase domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002472   Gene: ENSTRUG00000001056   Transcript: ENSTRUT00000002484
Sequence length 529
Comment pep:novel scaffold:FUGU4:scaffold_3610:4355:7402:-1 gene:ENSTRUG00000001056 transcript:ENSTRUT00000002484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYGGISVGGQLPVLELQQTIKDVATQMGRLLNVTGGKHSRKTLEDIETFLRYMETQNNVK
VWYNNKGWHAMASFMNVANNAILRAHLPKGANLAEYGITVINHPLNLTKKQLSEITVLTT
SVDAVVAICVIFAMSFIPASFVLYLIQERVTQAKHLQFVSGVSPLVYWMANFLWDMVNYS
IGVAMVVEIFIFFDKKCYTSAANLQPLIALLMLYGIPSTAYVSLSCINLFIGLNSSALTF
ILDLFENTTALHKLNQLLKTVLLIFPHYCLGRGLIDMAMNQAVTDIYAHFGEDYRLDPYN
WNFIGKNLFCMTIEGFLYFILTILFQYRFFLDHWVSDCPKPPVLDEDADVAGERARICKN
ERTNDILQIRDLSKTYKGTIIPAVNRICLGVSSGECFGLLGVNGAGKTTTIKMLTGDIDV
TTGEASVAGHCVLTNILDVHQNMGYCPQFDAIDELLTGREHLHLYARLRGVPEAEISRVA
EWAIQKLGLSQDANQSAGTYSGGNRRKLSTAIAMIGCPVLVLLVRQTLG
Download sequence
Identical sequences H2RQQ7
ENSTRUP00000002472 ENSTRUP00000002472 31033.ENSTRUP00000002472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]