SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002718 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002718
Domain Number 1 Region: 842-943
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-29
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002718   Gene: ENSTRUG00000001159   Transcript: ENSTRUT00000002734
Sequence length 948
Comment pep:novel scaffold:FUGU4:scaffold_283:150611:179925:-1 gene:ENSTRUG00000001159 transcript:ENSTRUT00000002734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTSLRDQLRTSSTKKIVSSASTSSLSALAKQTRGPTKSQDTEGLERGLLECQIKELLAEA
KAKDLEISNLRAELQHFMVKPSTPSSSAPSKCVTDEEQRQVDEALLLVGELREKNGTFQN
ELAVLREDNQILNGKLLSLEAYIASTPSKPFVNGLPYSSLRTSVSSSSDMTKDSPSPDSS
EFEKIPSCSESLHSGASGETGSIGAVMSSMGQNLSVQSLAEQIHKMEENQHSTAEELQAT
LQELADQQKMVQELTAENERLAEEKRLLQTSVQQQQECVEVLAQKNESLARRLQEQVQVQ
AQREEEICSQGPRLAELEQRYANLMESSHFEREKLVDIQQQLTGSLRSLEEEHQIAQGQV
CCLREEMDRLQAQLDQELESVGQATLVAEEQRATAESLRLENSRLKVQVDIERQKIGEMK
TIQNASDTAEVLSMLKAAHAERDRMEAELTTLREKLLHAQAETEHTRAALSMVEAKCQQV
QEQAEEREQVLHNQISSVEEERILAENQVKDLKENIFELEDQVEQQRAVNCHTNQAALDM
ENLAKKLEDQKAEAERQLKVLTRKLKDEKEEWRRFQADLQTAVVVANDIKVEAQQELRAL
RRQLQEEQERNATLSADLEALQGVRQAQEASNIYRKVHASECSLKIAACSKCLNEQEVHF
NKPSPKLAVVLRAFPTLKDGPLIRMHSTARSPLSGIPVRALPAATVSPMQRTSIKPSAKT
LEKRIHRAEFSHQYSTYIFLHHYLRESGPSGKPASHQPFLQDSVSLFTHLLCLIPSDKLS
GCSDDLKPTSLMRKSPSSLESVIKSTPSFSSHVVPPKDLECHKKRSWEPRHTALTWLRSR
YGGSKRNAPLKWCQKKTEGYPNIDVTNFSSSWSDGLAFCALLHTYLPAHIPYQELISQDK
MRNLTLAFQAAESIGIRPSLDMEELMRTDRPDWQSVMLYVKIYKYFET
Download sequence
Identical sequences H2RRF2
31033.ENSTRUP00000002718 ENSTRUP00000002718 ENSTRUP00000002718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]