SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002732 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002732
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000038
Family alpha-D-mannose-specific plant lectins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002732   Gene: ENSTRUG00000001167   Transcript: ENSTRUT00000002748
Sequence length 66
Comment pep:novel scaffold:FUGU4:scaffold_7640:4016:4298:1 gene:ENSTRUG00000001167 transcript:ENSTRUT00000002748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSINVLEKGSELKRGDSVLSNSQWIALFQHDGNFVVYRTEPVWASDTSGMDPTRLCMQGD
CNLVMY
Download sequence
Identical sequences H2RRG6
31033.ENSTRUP00000002732 ENSTRUP00000002732 ENSTRUP00000002732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]