SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003690 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003690
Domain Number 1 Region: 15-278
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.88e-54
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 290-513,560-605,648-696
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-37
Family Extended AAA-ATPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003690   Gene: ENSTRUG00000001596   Transcript: ENSTRUT00000003710
Sequence length 832
Comment pep:novel scaffold:FUGU4:scaffold_143:92083:96732:-1 gene:ENSTRUG00000001596 transcript:ENSTRUT00000003710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDMVDDHEMREAQRDYLDFLDDDQDQGIYQNKIRNMISENKARLIVNINDLRRRNEGR
AAKLMNTAFQELIAFQRALKDLVASVDATYAKQHEEFYVGLEGSFGSKHVTPRTLTSRLL
GNMVCVEGIITKCTQFKTFKWWYISSNMTALSVGSLVRPKVVRSVHYCPATKKTMERKYT
DMTSLDAFPSSAIYPTKDEENNPLETEFGLSIYKDHQTITVQEMPEKAPAGQLPRSVDII
LDNDLVDMVKPGDRVQVVGTYRCLPSKKGGFTSGTFSKDVFEQLAHSLAPSIHGHEYIKK
AILCLLLGGVEKVLENGSRIRGDINILLIGDPSVAKSQLLRYVLHTAPRAIPTTGRGSSG
VGLTAAVTTDQETGTIQYSIHGCARFLTLAHLPFPGERRLEAGAMVLADRGVVCIDEFDK
MSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQD
SLLSRFDLLFIVLDQMDPEQDREISDHVLRMHRYRDPREQEGAAMALGGTVDVLTTDNPD
SFSEEQEELQIYEKHNNLLHGNRRKKEKTVSKEFMRKYIHVAKAVTPVLTEEAANHIAEE
YSRLRSQDQMGTDIARVGWSQNPSINHDITNCLVSNLVYSLSSCQTSPVTARTLETLIRL
STAHAKARMSKAVELEDSEVAVELVQYAYFKKVRRATTNAWFWRKRRNALERVHAGSQGS
EPLSPYDFSEDQDVPESKHSKSTNLLQYALVEITHLKPVGFQVFLTKLKEFKSSLFAVFQ
SAHAQSVKMKTLMDDINKGREQHFSEAEVRDALAHMQDHNQIMLSDDIIFLI
Download sequence
Identical sequences H2RU73
31033.ENSTRUP00000003690 ENSTRUP00000003690 ENSTRUP00000003690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]